PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00056.1_g00042.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 183aa    MW: 21553.1 Da    PI: 7.8437
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00056.1_g00042.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.81.4e-1472133263
                              XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                              +e +rerr+ +NRe+ArrsR RKk++ieeL++ v++L   N+ L +++ +l +   +  +e+
  Rsa1.0_00056.1_g00042.1  72 PEERRERRMVSNRESARRSRMRKKKQIEELQQQVEQLMILNHNLSEKVINLLESNHQILQEN 133
                              5779*******************************************999999988888887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.5E-1471135IPR004827Basic-leucine zipper domain
PfamPF001702.2E-1373133IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.43873136IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.75E-1175127No hitNo description
Gene3DG3DSA:1.20.5.1702.2E-1175131No hitNo description
CDDcd147021.13E-1576127No hitNo description
PROSITE patternPS0003607893IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MESSPHRSHH CFDILEGMPP QDDHFNSSSL QNPSFHVHLQ SLSSNLPTRS NNNRYHLNPN  60
GETFCHRESF DPEERRERRM VSNRESARRS RMRKKKQIEE LQQQVEQLMI LNHNLSEKVI  120
NLLESNHQIL QENSQLKEKV NSFHLLMAEM LIPMRNVDGS ISDREVNHLR GETSNRTNTF  180
FGK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009111959.11e-115PREDICTED: basic leucine zipper 25-like
TrEMBLM4F4F71e-115M4F4F7_BRARP; Uncharacterized protein
TrEMBLA0A078FVP21e-115A0A078FVP2_BRANA; BnaA09g05450D protein
STRINGBra035957.1-P1e-115(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61852545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60830.18e-69basic leucine-zipper 70